Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chaetomium globosum High osmolarity signaling protein SHO1(SHO1)

Recombinant Chaetomium globosum High osmolarity signaling protein SHO1(SHO1)

SKU:CSB-CF642220CHI

Regular price $1,922.00 USD
Regular price Sale price $1,922.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)

Uniprot NO.:Q2H3I7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEYSRPQYGRKRMSLGNIIGDPFALATTSIATLAWLISFVATIIAHIQYPVKFPLFAYWA LVFYFGLIIGVFVVVASDSTQTYHVALVGYLGCGLVLSTSSVNNLIHDNQGAKEASAAGF ILLSMVTIVWIFYFGSAPSAVPRAYIDSFALAKESTSTNRQTMTGGYGGRRPETSTSVQP PQMYTAQLNGLENPSPVGGMTSAMTNPTIPPAYTAPPTQKTAAPNAENPNAEIVPPTEYP YRAKAIYSYEANPEDANEISFSKHEILEVSDVSGRWWQARKESGETGIAPSNYLILL

Protein Names:Recommended name: High osmolarity signaling protein SHO1 Alternative name(s): Osmosensor SHO1

Gene Names:Name:SHO1 ORF Names:CHGG_06778

Expression Region:1-297

Sequence Info:full length protein

View full details