Recombinant Caulobacter crescentus  UPF0391 membrane protein CCNA_00709 (CCNA_00709)

Recombinant Caulobacter crescentus UPF0391 membrane protein CCNA_00709 (CCNA_00709)

CSB-CF488773DQP
Regular price
$1,041.00 USD
Sale price
$1,041.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caulobacter crescentus (strain NA1000 / CB15N)

Uniprot NO.:B8H0S5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKWAIILAIVALIAGALGFSGLAGAAAGVAKILFFLFLVGFVLVLLLGGTVFKAATGPK

Protein Names:Recommended name: UPF0391 membrane protein CCNA_00709

Gene Names:Ordered Locus Names:CCNA_00709

Expression Region:1-60

Sequence Info:full length protein

Your list is ready to share