
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli
Uniprot NO.:P42501
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLIKVKSAVSWMRARLSAISLADIQKHLAKIIILAPMAMLLIYLAIFSQPRYMSESKVAI KRSDDLNSGSLNFGLLLGASNPSSAEDALYLKEYINSPDMLAALDKQLNFREAFSHSGLD FLNHLSKDETAEGFLKYYKDRINVSYDDKTGLLNIQTTGFSPEFALKFNQTVLKESERFI NEMSHRIARDQLAFAETEMEKARQRLDASKAELLSYQDNNNVLDPQAQAQAASTLVNTLM GQKIQMEADLRNLLTYLREDAPQVVSARNAIQSLQAQIDEEQSKITAPQGDKLNRMAVDF EEIKSKVEFNTELYKLTLTSIEKTRVEAARKLKVLSVISSPQLPQESSFPNIPYLIACWL LVCCLLFGTLKLLLAVIEDHRD
Protein Names:Recommended name: Capsule polysaccharide export inner-membrane protein kpsE
Gene Names:Name:kpsE
Expression Region:1-382
Sequence Info:full length protein
You may also like
-
Recombinant Capsule polysaccharide export inner-membrane protein kpsE(kpsE)
- Regular price
- $1,485.00 USD
- Sale price
- $1,485.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Capsule polysaccharide export inner-membrane protein kpsE(kpsE)
- Regular price
- $1,485.00 USD
- Sale price
- $1,485.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Capsule polysaccharide export inner-membrane protein BexC(bexC)
- Regular price
- $1,481.00 USD
- Sale price
- $1,481.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Capsule polysaccharide export inner-membrane protein BexB(bexB)
- Regular price
- $1,380.00 USD
- Sale price
- $1,380.00 USD
- Regular price
-
- Unit price
- per
Sold out