Skip to product information
1 of 1

Gene Bio Systems

Recombinant Candida glabrata Glycosylphosphatidylinositol anchor biosynthesis protein 11(GPI11)

Recombinant Candida glabrata Glycosylphosphatidylinositol anchor biosynthesis protein 11(GPI11)

SKU:CSB-CF739753CZI

Regular price $1,824.00 USD
Regular price Sale price $1,824.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Uniprot NO.:Q6FSD1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPVKKRTPLKHKSVSFSDDITQTQHNHHHRKKQNGERPPVFIRKTWLTIPWHLIALVYIY VKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACIVLSIPV VVIIILFGAPLLELLWETWLLALHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCWIS CVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYGAYL

Protein Names:Recommended name: Glycosylphosphatidylinositol anchor biosynthesis protein 11

Gene Names:Name:GPI11 Ordered Locus Names:CAGL0H01485g

Expression Region:1-217

Sequence Info:full length protein

View full details