Gene Bio Systems
Recombinant Candida dubliniensis Altered inheritance of mitochondria protein 11(AIM11)
Recombinant Candida dubliniensis Altered inheritance of mitochondria protein 11(AIM11)
SKU:CSB-CF498232CZH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) (Yeast)
Uniprot NO.:B9WD58
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTDLLHKLNFKIADASPEYKQRRKIQMIRFFTASAVTIFASRFAYRATVSRQYIPTLFQG NHSPPLSYNFTTDAAVAVGTGTLLCGSVTGMTVFGLCWILDVSNIQEFGWRMKSMLGGWE SEKKLSEAPMDEESSYIQDSLNDILDGKYDFEEDTEEVHTAEMKTK
Protein Names:Recommended name: Altered inheritance of mitochondria protein 11
Gene Names:Name:AIM11 ORF Names:CD36_80770
Expression Region:1-166
Sequence Info:full length protein
