Skip to product information
1 of 1

Gene Bio Systems

Recombinant Candida albicans Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)

Recombinant Candida albicans Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)

SKU:CSB-CF682478CZD

Regular price $1,722.00 USD
Regular price Sale price $1,722.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Uniprot NO.:Q5AEM8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NTIAGVFTGLGGAFITLSYLGNIEIDVEKPIMGFDPLMVMGGAVILGGLVGFLVGPFIGS SIFRLTNRAQLKQFELKNTEFLSRLRIKRPDPSSQSFSNPIPDYYGEKIYSLKDYKQWLR DCNAFRRKSKEFL

Protein Names:Recommended name: Presequence translocated-associated motor subunit PAM17, mitochondrial

Gene Names:Name:PAM17 ORF Names:CaO19.240, CaO19.7870

Expression Region:53-185

Sequence Info:full length protein

View full details