Gene Bio Systems
Recombinant Candida albicans Assembly factor CBP4(CBP4)
Recombinant Candida albicans Assembly factor CBP4(CBP4)
SKU:CSB-CF691383CZD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Uniprot NO.:Q59QC6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSAVKPLWYRWARVYFAGGCLVGTGVLFWYTIRPTDEQLIARFSPEVKADYERNKELRQQ EQKRLIEIVKETSSSSDPIWKAGPIGSPFEKEQRNLSMELVDAELFHKTKHEEQQKQEID RANEESKEAERLMQQNKKPWWKFF
Protein Names:Recommended name: Assembly factor CBP4 Alternative name(s): Cytochrome b mRNA-processing protein 4
Gene Names:Name:CBP4 ORF Names:CaO19.392, CaO19.8022
Expression Region:1-144
Sequence Info:full length protein
