Skip to product information
1 of 1

Gene Bio Systems

Recombinant Campylobacter jejuni subsp. doylei UPF0059 membrane protein JJD26997_0180 (JJD26997_0180)

Recombinant Campylobacter jejuni subsp. doylei UPF0059 membrane protein JJD26997_0180 (JJD26997_0180)

SKU:CSB-CF418171CWE

Regular price $1,789.00 USD
Regular price Sale price $1,789.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)

Uniprot NO.:A7H1P4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFYSLIFLSCALGMDAFAVSLCKSFSVKKLHLKHYLIVGIYFGGFQALMPTIGYFIGIT FASFIASIDHWIAFILLSLIGLKMIKESLENENCNSNAKQFGFKTMLALAIATSIDALAV GVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNKAELLGGLVLIILGVKIL IEHLFFD

Protein Names:Recommended name: UPF0059 membrane protein JJD26997_0180

Gene Names:Ordered Locus Names:JJD26997_0180

Expression Region:1-187

Sequence Info:full length protein

View full details