Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha

SKU: CSB-EP888242CBG

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q9I841

Gene Names: N/A

Organism: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

AA Sequence: GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Expression Region: 1-136aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 31.8 kDa

Alternative Name(s): Aggretin alpha chain Rhodoaggretin subunit alpha

Relevance: Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Reference: "Aggretin, a heterodimeric C-type lectin from Calloselasma rhodostoma (malayan pit viper), stimulates platelets by binding to alpha 2beta 1 integrin and glycoprotein Ib, activating Syk and phospholipase Cgamma 2, but does not involve the glycoprotein VI/Fc receptor gamma chain collagen receptor."Navdaev A., Clemetson J.M., Polgar J., Kehrel B.E., Glauner M., Magnenat E., Wells T.N.C., Clemetson K.J.J. Biol. Chem. 276:20882-20889(2001).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.