Skip to product information
1 of 1

GeneBio Systems

Recombinant Caenorhabditis elegans Dauer larva development regulatory growth factor daf-7 (daf-7)

Recombinant Caenorhabditis elegans Dauer larva development regulatory growth factor daf-7 (daf-7)

SKU:P92172

Regular price $1,068.00 USD
Regular price Sale price $1,068.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P92172

Gene Names: daf-7

Alternative Name(s): (Abnormal dauer formation protein 7)

Abbreviation: Recombinant Caenorhabditis elegans daf-7 protein

Organism: Caenorhabditis elegans

Source: E.coli

Expression Region: 235-350aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: SHAKPVCNAEAQSKGCCLYDLEIEFEKIGWDWIVAPPRYNAYMCRGDCHYNAHHFNLAETGHSKIMRAAHKVSNPEIGYCCHPTEYDYIKLIYVNRDGRVSIANVNGMIAKKCGCS

MW: 18.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Under harsh environmental conditions, larvae enter a developmentally arrested state known as dauer; TGF-beta-like daf-7 acts to inhibit dauer larva formation and promote growth. May be a ligand to cell surface receptor daf-4. May act as a negative regulator of dauer larva development by transducing chemosensory information from ASI neurons. Involved in sensitivity to CO2 levels. Involved in mate searching behavior of males, acting in concert with the neuropeptide pdf-1. In AWC neurons, acts to promote expression of srsx-3, a member of the GPCR family.

Reference: "The homeodomain protein hmbx-1 maintains asymmetric gene expression in adult C. elegans olfactory neurons." Lesch B.J., Bargmann C.I. Genes Dev. 24: 1802-1815(2010)

Function:

View full details