Skip to product information
1 of 1

Gene Bio Systems

Recombinant Burkholderia xenovorans UPF0060 membrane protein Bxeno_B1021(Bxeno_B1021)

Recombinant Burkholderia xenovorans UPF0060 membrane protein Bxeno_B1021(Bxeno_B1021)

SKU:CSB-CF621721BNV

Regular price $1,687.00 USD
Regular price Sale price $1,687.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Burkholderia xenovorans (strain LB400)

Uniprot NO.:Q13PK0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKTFLLYAVTAVAEIVGCYLPWRWLKEGGSIWLLVPGALSLALFAWLLTLHGTAAGRVYA AYGGVYVAVAIAWLWCVDKVRPTLWDAAGVVFTLAGMAIIAFQPRV

Protein Names:Recommended name: UPF0060 membrane protein Bxeno_B1021

Gene Names:Ordered Locus Names:Bxeno_B1021 ORF Names:Bxe_B1996

Expression Region:1-106

Sequence Info:full length protein

View full details