Gene Bio Systems
Recombinant Burkholderia ambifaria Large-conductance mechanosensitive channel(mscL)
Recombinant Burkholderia ambifaria Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF601901BAAF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD))
Uniprot NO.:Q0BEC9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSIIKEFKEFAVKGNVMDLAVGVIIGGAFSKIVDSVVKDLIMPVIGVLTGGLDFSNKFVL LGTIPPTFKGNPDSFKDLQAAGVAAFGYGSFITVAINFVILAFIIFLMVKFINKLRKPEE AAPAATPEDIVLLREIRDSLKQR
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:Bamb_1938
Expression Region:1-143
Sequence Info:full length protein
