Recombinant Bunyavirus La Crosse Nucleoprotein(N)

Recombinant Bunyavirus La Crosse Nucleoprotein(N)

CSB-YP361397BNO
Regular price
$874.00 USD
Sale price
$874.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Microbiology

Target / Protein: N

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Bunyavirus La Crosse

Delivery time: 3-7 business days

Uniprot ID: P04873

AA Sequence: MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-235aa

Protein length: Full Length

MW: 28.5 kDa

Alternative Name(s): Nucleocapsid protein

Relevance: Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation

Reference: "Structural basis for encapsidation of genomic RNA by La Crosse Orthobunyavirus nucleoprotein." Reguera J., Malet H., Weber F., Cusack S. Proc. Natl. Acad. Sci. U.S.A. 110:7246-7251(2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share