Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P60615
Gene Names: N/A
Organism: Bungarus multicinctus (Many-banded krait)
AA Sequence: IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Expression Region: 22-95aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
MW: 38 kDa
Alternative Name(s): Short name: Alpha-BTX A31 Short name: Alpha-Bgt(A31) Short name: BGTX A31 Alternative name(s): Long neurotoxin 1
Relevance: Binds with high affinity to muscular (alpha-1/CHRNA1) and neuronal (alpha-7/CHRNA7) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscular and neuronal transmission. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 µM).
Reference: "Genetic organization of alpha-bungarotoxins from Bungarus multicinctus (Taiwan banded krait): evidence showing that the production of alpha-bungarotoxin isotoxins is not derived from edited mRNAs." Chang L.-S., Lin S.-K., Huang H.-B., Hsiao M. Nucleic Acids Res. 27:3970-3975(1999)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.