Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0056 membrane protein BUsg_434(BUsg_434)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0056 membrane protein BUsg_434(BUsg_434)

SKU:CSB-CF813026BXE

Regular price $1,871.00 USD
Regular price Sale price $1,871.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Uniprot NO.:Q8K9B4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNEIISTTILLILIMDPLGNLPIFMTILKKLDAKRRRIVVIREMIIALIVMLIFLFVGEK ILTILNLKTETVSISGGIILFLIAIKMIFPSDEGNNGTSSEEEPFLVPLAIPLVAGPSLL ATLMLLSHQYLHHMPYLVGSLLIAWFFTIIILLLSGLFLKLFGDKGVNALERLMGLILIM LSTQMFLDGIKAWFKN

Protein Names:Recommended name: UPF0056 membrane protein BUsg_434

Gene Names:Ordered Locus Names:BUsg_434

Expression Region:1-196

Sequence Info:full length protein

View full details