Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Ubiquinol oxidase subunit 2(cyoA)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Ubiquinol oxidase subunit 2(cyoA)

SKU:CSB-CF810422BXE

Regular price $1,885.00 USD
Regular price Sale price $1,885.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Uniprot NO.:Q8K993

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CDSILFNPHGIIAIQECSILLISFLIMLFVIIPVIFMTIYFSVKYRASNINAKYKPDWCD SKKIEIIVWTIPISIILFLAFVTWNYSHILDPKKSIISKYKPIKIDVVSLDWRWLFIYPE YHIATINEIMFPINRSIIFHITSNSVMNSFFIPSLGSQIYAMPGMMTTLNLMSNSPGKYK GISSNYSGKGFSNMKFTAISVLNIKDFENWIKKAQQSPKKLNKMSIFNIISLPNENHFIE YFSDVKKNLFYEIINQTYSKNKVFKH

Protein Names:Recommended name: Ubiquinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Cytochrome o subunit 2 Cytochrome o ubiquinol oxidase subunit 2 Oxidase BO(3) subunit 2 Ubiquinol oxidase polypeptide II

Gene Names:Name:cyoA Ordered Locus Names:BUsg_456

Expression Region:25-290

Sequence Info:full length protein

View full details