Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Uniprot NO.:Q89AV7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDNFISHIYAVENSTTIPSSNSYSLIFMLLVFLSIFYFMIFRPQRKKIQEHDRLIKSLSY GDEVFTSSGFVGKIVKITKTGYIVLELNNNVEVFVKSDFIVSIFPKGTLKNMKSM
Protein Names:Recommended name: UPF0092 membrane protein bbp_125
Gene Names:Ordered Locus Names:bbp_125
Expression Region:1-115
Sequence Info:full length protein