Gene Bio Systems
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0092 membrane protein BU134 (BU134)
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0092 membrane protein BU134 (BU134)
SKU:CSB-CF348123BWZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Uniprot NO.:P57234
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFFIQNANAVVNGTSESSNSYSLIFMAVIFLLIFYFMLFRPQQKKDKEHKNLINSLVQG DEVITTSGLLGRIKKITKNGYILLELNETTEVFIKQDFIVSLLPKGTLKSL
Protein Names:Recommended name: UPF0092 membrane protein BU134
Gene Names:Ordered Locus Names:BU134
Expression Region:1-111
Sequence Info:full length protein
