Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable intracellular septation protein A (BU275)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable intracellular septation protein A (BU275)

SKU:CSB-CF348786BWZ

Regular price $1,776.00 USD
Regular price Sale price $1,776.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Uniprot NO.:P57363

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQILNILPMFIFFIFYKFYDIFIASGSLIVISGLICIIHWIFYNEIDKISLFSFLSVFF FGSLTIFFHNSQFIKWKITIIYIIFSLVLLISQFFTRKPMIQRFLEKDIKISNIYWRKIN FIWSLFFLFCAILNIYIAYYFSETIWVNFKVFGFTSLTFFLILITSIYINCKISKNK

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:BU275

Expression Region:1-177

Sequence Info:full length protein

View full details