Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Uniprot NO.:P57152
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNKHHYNRNKHKIPEKVKWISISIFFILSFFINMCFYETQLFIRIFIISCLMLCAIGTMI YTKKGKDILLYIVMSKKEMQKIIWPKYKETLYTTFIVISVTIFISFILWSIDSVIFRLIA FIISLRF
Protein Names:Recommended name: Preprotein translocase subunit SecE
Gene Names:Name:secE Ordered Locus Names:BU040
Expression Region:1-127
Sequence Info:full length protein