Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB2(virB2)

SKU: CSB-CF879578BMO

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Uniprot NO.:Q9RPY3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:NGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAA AEIASYLLR

Protein Names:Recommended name: Type IV secretion system protein virB2

Gene Names:Name:virB2 Ordered Locus Names:BMEII0026

Expression Region:37-105

Sequence Info:full length protein