Recombinant Brucella melitensis biotype 1  Protein CrcB homolog 4(crcB4)

Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 4(crcB4)

CSB-CF838174BMO
Regular price
$1,087.00 USD
Sale price
$1,087.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Uniprot NO.:Q8YCQ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLL GGYTTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG

Protein Names:Recommended name: Protein CrcB homolog 4

Gene Names:Name:crcB4 Ordered Locus Names:BMEII0470

Expression Region:1-115

Sequence Info:full length protein