Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella canis Probable intracellular septation protein A (BCAN_A1979)

Recombinant Brucella canis Probable intracellular septation protein A (BCAN_A1979)

SKU:CSB-CF434722BPH

Regular price $1,830.00 USD
Regular price Sale price $1,830.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Brucella canis (strain ATCC 23365 / NCTC 10854)

Uniprot NO.:A9M8S1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHPVFERDPSEKSETERREVPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAP IFLATALFMAATVIALAISWSMTRTLPIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIV NTLFGGILLGGLFFGKSLLGYVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFS TDTWVSFKVWGIMPITIVFTLLQMPLIQKHSLTDEENTAS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:BCAN_A1979

Expression Region:1-220

Sequence Info:full length protein

View full details