Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella abortus Lectin-like protein BA14k (BAbS19_II04750)

Recombinant Brucella abortus Lectin-like protein BA14k (BAbS19_II04750)

SKU:CSB-CF460528BWR

Regular price $1,554.00 USD
Regular price Sale price $1,554.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella abortus (strain S19)

Uniprot NO.:B2SAT5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R

Protein Names:Recommended name: Lectin-like protein BA14k

Gene Names:Ordered Locus Names:BAbS19_II04750

Expression Region:27-147

Sequence Info:full length protein

View full details