Gene Bio Systems
Recombinant Brucella abortus biovar 1 Protein CrcB homolog 4(crcB4)
Recombinant Brucella abortus biovar 1 Protein CrcB homolog 4(crcB4)
SKU:CSB-CF688055BWS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Brucella abortus biovar 1 (strain 9-941)
Uniprot NO.:Q578U0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVEASILVLVGGFIGGVMRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARL GGIFSTTIFHEFIMVGLLGGYTTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAA GYGGIMWIMEWPG
Protein Names:Recommended name: Protein CrcB homolog 4
Gene Names:Name:crcB4 Ordered Locus Names:BruAb2_0415
Expression Region:1-133
Sequence Info:full length protein
