Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella abortus Aquaporin Z(aqpZ)

Recombinant Brucella abortus Aquaporin Z(aqpZ)

SKU:CSB-CF652178BMN

Regular price $1,908.00 USD
Regular price Sale price $1,908.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Brucella abortus (strain 2308)

Uniprot NO.:Q2YR68

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGG HFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYG ELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAGFAPIAIGFGLTLIHLVSIPVTN TSVNPARSTGVALFADRAALSQLWLFWVAPLVGAVIGAIIWKGLLGRD

Protein Names:Recommended name: Aquaporin Z Alternative name(s): Aquaporin X

Gene Names:Name:aqpZ Synonyms:aqpX Ordered Locus Names:BAB1_2001

Expression Region:1-228

Sequence Info:full length protein

View full details