Gene Bio Systems
Recombinant Brassica napus Oleosin-B2(OlnB2)
Recombinant Brassica napus Oleosin-B2(OlnB2)
SKU:CSB-CF339025BWD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Brassica napus (Rape)
Uniprot NO.:P29526
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LQSPLRKIIVNRIKARLGGGGGGSRLARLKKILGLLNKLRGMGAGGAAAPAAEPAPAAEA APAAEAAPAAAPAAAPAAAP
Protein Names:Recommended name: Oleosin-B2 Alternative name(s): Oleosin-C98 Cleaved into the following chain: 1. Pollen coat protein B2
Gene Names:Name:OlnB2 Synonyms:C98
Expression Region:104-183
Sequence Info:full length protein
