Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine V-type proton ATPase 21 kDa proteolipid subunit(ATP6V0B)

Recombinant Bovine V-type proton ATPase 21 kDa proteolipid subunit(ATP6V0B)

SKU:CSB-CF647978BO

Regular price $1,811.00 USD
Regular price Sale price $1,811.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q2TA24

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTGLVLLYSGVFVAFWACLLVVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISL SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSA TDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE IFGSAIGLFGVIVAILQTSRVKMGD

Protein Names:Recommended name: V-type proton ATPase 21 kDa proteolipid subunit Short name= V-ATPase 21 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 21 kDa proteolipid subunit

Gene Names:Name:ATP6V0B

Expression Region:1-205

Sequence Info:full length protein

View full details