Gene Bio Systems
Recombinant Bovine UPF0466 protein C22orf32 homolog, mitochondrial
Recombinant Bovine UPF0466 protein C22orf32 homolog, mitochondrial
SKU:CSB-CF640793BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q2M2S2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD
Protein Names:Recommended name: UPF0466 protein C22orf32 homolog, mitochondrial
Gene Names:
Expression Region:48-107
Sequence Info:full length protein
