Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A)

Recombinant Bovine Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A)

SKU:CSB-CF023977BO

Regular price $2,171.00 USD
Regular price Sale price $2,171.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:O19131

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VYPAGVQGLVPHPGDLEKRESPCPQGKYNHPQNSTICCTKCHKGTYLYNDCPGPGRDTDCRVCAPGTYTALENHLRRCLSCSRCRDEMFQVEISPCVVDRDTVCGCRKNQYREYWGETGFRCLNCSLCPNGTVNIPCQERQDTICHCHMGFFLKGAKCISCHDCKNKECEKLCPTRPSTGKDSQDPGTTVLLPLVIVFGLCLASFASVVLACRYQRWKPKLYSIICGQSTLVKEGEPELLVPAPGFNPTTTICFSSTPSSSPVSIPPYISCDRSNFGAVASPSSETAPPHLKAGPILPGPPASTHLCTPGPPASTHLCTPGPPASTHLCTPVQKWEASAPSAPDQLADADPATLYAVVDGVPPSRWKELVRRLGLSEHEIERLELENGRHLREAQYSMLAAWRRRTPRREATLELLGRVLRDMDLLGCLENIEEALGGAARLASEPRLLW

Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 1A Alternative name(s): Tumor necrosis factor receptor 1 Short name= TNF-R1 Tumor necrosis factor receptor type I Short name= TNF-RI Short name= TNFR-I p55 p60 CD_antigen= CD120a

Gene Names:Name:TNFRSF1A Synonyms:TNFR1

Expression Region:22-471

Sequence Info:full length protein

View full details