Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Transmembrane protein 70, mitochondrial(TMEM70)

Recombinant Bovine Transmembrane protein 70, mitochondrial(TMEM70)

SKU:CSB-CF023874BO

Regular price $1,773.00 USD
Regular price Sale price $1,773.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A6H773

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SHTQLDKSEDGRLIYTGNLARTVFGVKCFSYSTSLISLAFLPYIFAQNNVIFGSLPLQIL FYGTIGSFTVITPALLHFLTKGYVIRLYHEARTDTYKAITYSVVLSEKSTVFHQNDVKIP NSTHVFTTFYAKTKSLLVNPALFPNPEDYNHLMGYDKPFTFDLEEASEKKQLKEEK

Protein Names:Recommended name: Transmembrane protein 70, mitochondrial

Gene Names:Name:TMEM70

Expression Region:79-254

Sequence Info:Full length protein

View full details