Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Transmembrane protein 150B(TMEM150B)

Recombinant Bovine Transmembrane protein 150B(TMEM150B)

SKU:CSB-CF417665BO

Regular price $1,815.00 USD
Regular price Sale price $1,815.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A7MBB3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LAVVNKAVNLTDGFPYISVCGNVPPQSCIFSQVLNIGAASAAWICILRYYQLRDWGVRKW HNQVILWTGLLCALGTSIVGNFQEKNQRATHLTGAFLAFFVGIVYFWLQLFLSWRMKNLP QPGAPWIGPLRLVLCSACFILEVAMVVLHSWSMRSVSAICEWVAAMLLFILFGLLAVDFS RLDSCTLCLQPGSGSLRPPPDSPTSLHVQL

Protein Names:Recommended name: Transmembrane protein 150B Alternative name(s): Transmembrane protein 224

Gene Names:Name:TMEM150B Synonyms:TMEM224

Expression Region:26-235

Sequence Info:full length protein

View full details