Gene Bio Systems
Recombinant Bovine Translocator protein(TSPO)
Recombinant Bovine Translocator protein(TSPO)
SKU:CSB-CF025168BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:P30535
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAPPWVPAVGFTLLPSLGGFLGAQYTRGEGFRWYASLQKPPWHPPRWILAPIWGTLYSAM GYGSYMIWKELGGFSKEAVVPLGLYAGQLALNWAWPPLFFGTRQMGWALVDLLLTGGMAA ATAMAWHQVSPPAACLLYPYLAWLAFAGMLNYRMWQDNQVRRSGRRLSE
Protein Names:Recommended name: Translocator protein Alternative name(s): Isoquinoline-binding protein Short name= IBP PKBS Peripheral-type benzodiazepine receptor Short name= PBR
Gene Names:Name:TSPO Synonyms:BZRP
Expression Region:1-169
Sequence Info:Full length protein
