Gene Bio Systems
Recombinant Bovine Protein shisa-2 homolog(SHISA2)
Recombinant Bovine Protein shisa-2 homolog(SHISA2)
SKU:CSB-CF021267BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:A6QPA0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SGEYCHGWLDAQGVWRIGFQCPERFDGGDATICCGSCALRYCCSSADARLDQGGCDNDRQQGAGEPGRADKDGPDGSAVPIYVPFLIVGSVFVAFIVLGSLVAACCCRCLRPKQEPQLSRAPGGPRLVETIPMIPSASTSRGSSSRQSSTAASSSSSANSGARAPPTRSQTNCCLPEGTMNNVYVNMPTNFSVLNCQQATQIVPHQGQYLHPPFVGYTVQPDSVPLTPVPPFLDGLQTGYRQLQAPFPHTNSEQKMYPAVTV
Protein Names:Recommended name: Protein shisa-2 homolog Alternative name(s): Transmembrane protein 46
Gene Names:Name:SHISA2 Synonyms:TMEM46
Expression Region:28-289
Sequence Info:full length protein
