Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Protein MAL2(MAL2)

Recombinant Bovine Protein MAL2(MAL2)

SKU:CSB-CF013373BO

Regular price $1,771.00 USD
Regular price Sale price $1,771.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A2VE13

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAGGAPVPPPPNPAMSFPAPRVTLPAGPDILRTYSGAFVCLEIVFGGLVWILVASSNVP LPLLQGWVMFVSVTAFVCSLLFLGVFLSGVVTQINANWNFLDFAYHFTVFVFYFGAFLLE AATTSLHDLRCNRTMTVQPLLSDNQYNINVAATIFAFVTTACYGCSLGLALRRWRP

Protein Names:Recommended name: Protein MAL2

Gene Names:Name:MAL2

Expression Region:1-176

Sequence Info:Full length protein

View full details