
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q3ZBS2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT IARQTARCACRKGQIAGTTRARPACVDARIIRTKQWCDMLPCLEGEGCDLLINRSGWTCT QPGGRIKTTTVS
Protein Names:Recommended name: Protein FAM19A5 Alternative name(s): Chemokine-like protein TAFA-5
Gene Names:Name:FAM19A5 Synonyms:TAFA5
Expression Region:1-132
Sequence Info:full length protein