Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Peroxisomal membrane protein 4(PXMP4)

Recombinant Bovine Peroxisomal membrane protein 4(PXMP4)

SKU:CSB-CF019111BO

Regular price $1,817.00 USD
Regular price Sale price $1,817.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A5PJL1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VAPPQLRALLFAINALLSKRRYHAALAMLKGFRNGAVYGAKIRAPHALVMTFLFRSGSLR EKLRAILQATYTHSWNLARFVFLYKGLCALQSHVQGKTYQAHSFVSAFIGGLLVFGNNNN INSQISMYLLSRVLFALCRLGVEKGFIPEPRLDPFPWFSGLVWGLVLWLFEYHRPTLQPS LQSSMTYLYEDSNVWHDLSDFFIYNKSQPSK

Protein Names:Recommended name: Peroxisomal membrane protein 4

Gene Names:Name:PXMP4

Expression Region:2-212

Sequence Info:Full length protein

View full details