Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Peripheral myelin protein 22(PMP22)

Recombinant Bovine Peripheral myelin protein 22(PMP22)

SKU:CSB-CF018241BO

Regular price $1,754.00 USD
Regular price Sale price $1,754.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q9TQZ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLLLLLGIIVLHVAVLVLLFVSTIVSQWMVGNGHATDLWQNCSTSLMGSVQHCFSSSANE WLQSVQATMILSIIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAASIYTVR HPEWHFNSDGSYGFAYILAWVAFPLALLSGVIYVILRKRE

Protein Names:Recommended name: Peripheral myelin protein 22 Short name= PMP-22 Alternative name(s): PAS positive glycoprotein Short name= PASII

Gene Names:Name:PMP22

Expression Region:1-160

Sequence Info:full length protein

View full details