Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Peptidyl-prolyl cis-trans isomerase FKBP11(FKBP11)

Recombinant Bovine Peptidyl-prolyl cis-trans isomerase FKBP11(FKBP11)

SKU:CSB-CF652900BO

Regular price $1,772.00 USD
Regular price Sale price $1,772.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q2YDL5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GSETESPVRTLQVETLVEPPEPCAEPATFGDTLHIHYSGSLVDGRIFDTSLTRDPLVIEL GQKQVIPGLEQSLLDMCVGEKRRVIIPSHLAYGKRGFPPSIPADAELHFDVELIALIRAN YWQKLVKGILPLVGMAMVPALLGLIGYHLYRKASSPKISKNKLKEEKRNKSKKK

Protein Names:Recommended name: Peptidyl-prolyl cis-trans isomerase FKBP11 Short name= PPIase FKBP11 EC= 5.2.1.8 Alternative name(s): FK506-binding protein 11 Short name= FKBP-11 Rotamase

Gene Names:Name:FKBP11

Expression Region:30-203

Sequence Info:full length protein

View full details