Recombinant Bovine Leukocyte cell-derived chemotaxin 1(LECT1)

Recombinant Bovine Leukocyte cell-derived chemotaxin 1(LECT1)

CSB-CF012854BO
Regular price
$1,089.00 USD
Sale price
$1,089.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P17404

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ELVRKIVTTTTTRRLRSGPQGTPAPGRPNNGTRPSVQEDAEPFNPDNPYHQQEGESMTFD PRLDHEGICCIECRRSYTHCQKICEPLGGYHPWPYNYQGCRSACRVIMPCSWWVARILGM V

Protein Names:Recommended name: Leukocyte cell-derived chemotaxin 1 Alternative name(s): Small cartilage-derived glycoprotein Short name= SCGP Cleaved into the following 2 chains: 1. Chondrosurfactant protein Short name= 2. CH-SP 3. Chondr

Gene Names:Name:LECT1 Synonyms:CHMI

Expression Region:215-335

Sequence Info:Full length protein