Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Lens fiber membrane intrinsic protein(LIM2)

Recombinant Bovine Lens fiber membrane intrinsic protein(LIM2)

SKU:CSB-CF012946BO

Regular price $1,772.00 USD
Regular price Sale price $1,772.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P20274

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYSFMGGGLFCAWVGTILLVVATATDHWMQYRLSGAFAHQGLWRYCLGTKCYLQTESIAY WNATRAFMILSSLCATSGIIMGIVAFAQQPTFTRLSRPFSAGIMFFASTFFVLLALAIYT GVTVSFLGRRFGDWRFSWSYILGWVALLMTFFAGIFYMCAYRMHECRRLSTPR

Protein Names:Recommended name: Lens fiber membrane intrinsic protein Alternative name(s): MP18 MP19 MP20 MP21 MP23

Gene Names:Name:LIM2

Expression Region:1-173

Sequence Info:Full length protein

View full details