Skip to product information
1 of 1

GeneBio Systems

Recombinant Bovine Interleukin-3 (IL3)

Recombinant Bovine Interleukin-3 (IL3)

SKU:P49875

Regular price $599.00 USD
Regular price Sale price $599.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Immunology

Uniprot ID: P49875

Gene Names: IL3

Alternative Name(s): IL-3;Hematopoietic growth factor;Mast cell growth factor;MCGF;Multipotential colony-stimulating factor;P-cell-stimulating factor

Abbreviation: Recombinant Bovine IL3 protein

Organism: Bos taurus (Bovine)

Source: E.coli

Expression Region: 18-144aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: APQAKGLPVVTSRTPYSMLMKEIMDDLKKITPSPEGSLNSDEKNFLTKESLLQANLKVFMTFATDTFGSDSKIMKNLKEFQPVLPTATPTEDPIFIENKNLGDFRMKLEEYLVIIRNYLKSKNIWFS

MW: 21.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. ; This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Reference:

Function:

View full details