Gene Bio Systems
Recombinant Bovine Interferon alpha-inducible protein 6(IFI6)
Recombinant Bovine Interferon alpha-inducible protein 6(IFI6)
SKU:CSB-CF753694BO-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q6IED8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CCEEEDEKRYSEENSDSSFWGMVTYMAVGGGLMAAALPMLGFASTGIAANSLASSLMSWS AVANGGGVPAGGLVATLQSLGASGGSALMAKIGAFLGYTVHKQVESRQKESKEKK
Protein Names:Recommended name: Interferon alpha-inducible protein 6 Alternative name(s): Interferon-induced protein 6-16 Short name= Ifi-6-16
Gene Names:Name:IFI6
Expression Region:20-134
Sequence Info:full length protein
