Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Interferon alpha-inducible protein 6(IFI6)

Recombinant Bovine Interferon alpha-inducible protein 6(IFI6)

SKU:CSB-CF753694BO-GB

Regular price $1,761.00 USD
Regular price Sale price $1,761.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q6IED8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CCEEEDEKRYSEENSDSSFWGMVTYMAVGGGLMAAALPMLGFASTGIAANSLASSLMSWS AVANGGGVPAGGLVATLQSLGASGGSALMAKIGAFLGYTVHKQVESRQKESKEKK

Protein Names:Recommended name: Interferon alpha-inducible protein 6 Alternative name(s): Interferon-induced protein 6-16 Short name= Ifi-6-16

Gene Names:Name:IFI6

Expression Region:20-134

Sequence Info:full length protein

View full details