Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Guanine nucleotide-binding protein G(t) subunit alpha-2(GNAT2)

Recombinant Bovine Guanine nucleotide-binding protein G(t) subunit alpha-2(GNAT2)

SKU:CSB-EP009599BO

Regular price $963.00 USD
Regular price Sale price $963.00 USD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Neuroscience

Target / Protein: GNAT2

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Bos taurus (Bovine)

Delivery time: 3-7 business days

Uniprot ID: P04696

AA Sequence: GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCVDNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDSASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF

Tag info: N-terminal 6xHis-tagged

Expression Region: 2-354aa

Protein length: Full Length of Mature Protein

MW: 44.0 kDa

Alternative Name(s): Transducin alpha-2 chain

Relevance: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase.

Reference: "Sequence of the alpha subunit of photoreceptor G protein: homologies between transducin, ras, and elongation factors." Lochrie M.A., Hurley J.B., Simon M.I. Science 228:96-99(1985)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details