Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Cytochrome c oxidase subunit 6A2, mitochondrial(COX6A2)

Recombinant Bovine Cytochrome c oxidase subunit 6A2, mitochondrial(COX6A2)

SKU:CSB-CF005849BO

Regular price $1,664.00 USD
Regular price Sale price $1,664.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P07471

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPF SWGDGNHTFFHNPRVNPLPTGYEKP

Protein Names:Recommended name: Cytochrome c oxidase subunit 6A2, mitochondrial Alternative name(s): Cytochrome c oxidase polypeptide VIa-heart Short name= COXVIAH Cytochrome c oxidase polypeptide VIb

Gene Names:Name:COX6A2 Synonyms:COX6A

Expression Region:13-97

Sequence Info:Full length protein

View full details