Recombinant Bovine CD99 antigen-like protein 2(CD99L2)

SKU: CSB-CF004975BO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A1A4K1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DTGGFRLEDAVEGTSSVKQRWDHVTTTTRRPGATRAPAKPAGPPAEDDFNLADALDDQNDRDHDRKKPSIGGGGFSDKDLEDIVGGGDYKPDKGKGGGQYGGGDNSDDSGMSAETGTIAGVASALAMALIGAVSSYISYQQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSALQTQSTEPPPPEPPRI

Protein Names:Recommended name: CD99 antigen-like protein 2 Alternative name(s): CD_antigen= CD99

Gene Names:Name:CD99L2

Expression Region:26-217

Sequence Info:full length protein