Skip to product information
1 of 1

Gene Bio Systems

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0268(BB_0268)

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0268(BB_0268)

SKU:CSB-CF676025BUD

Regular price $1,755.00 USD
Regular price Sale price $1,755.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Uniprot NO.:Q44756

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFISRELKYILLTSVSALFISAVLGLFCGLSFFTILVRSLLQFVFFFVIGLLIEYIFKKY LSNLFSTELSGNMENKPQDDKKSDKDFKENLDFQNKNSLYENSQNISSSGDFIEEVKKYK FETEDVSRGSDKNKKMSFIEDNDPKVVADAIKTLMSKKE

Protein Names:Recommended name: Uncharacterized protein BB_0268 Alternative name(s): ORF36

Gene Names:Ordered Locus Names:BB_0268

Expression Region:1-159

Sequence Info:full length protein

View full details