Skip to product information
1 of 1

Gene Bio Systems

Recombinant Borrelia burgdorferi Flagellar biosynthetic protein FliQ(fliQ)

Recombinant Borrelia burgdorferi Flagellar biosynthetic protein FliQ(fliQ)

SKU:CSB-CF673792BUD

Regular price $1,491.00 USD
Regular price Sale price $1,491.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)

Uniprot NO.:Q44906

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAGHILYLIRISIENIIILSAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILL VIVIFGPWILNKLMQFTYMIFSQLQNV

Protein Names:Recommended name: Flagellar biosynthetic protein FliQ

Gene Names:Name:fliQ Ordered Locus Names:BB_0274

Expression Region:1-87

Sequence Info:full length protein

View full details