Gene Bio Systems
Recombinant Biofilm PGA synthesis protein PgaD(pgaD)
Recombinant Biofilm PGA synthesis protein PgaD(pgaD)
SKU:CSB-CF301663EOD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O157:H7
Uniprot NO.:P69433
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MNNLIITTRQSPVRLLVDYVATTILWTLFALFIFLFAMDLLTGYYWQSEARSRLQFYFLL AVANAVVLIVWALYNKLRFQKQQHHAAYQYTPQEYAESLAIPDELYQQLQKSHRMSVHFT SQGQIKMVVSEKALVRA
Protein Names:Recommended name: Biofilm PGA synthesis protein PgaD
Gene Names:Name:pgaD Ordered Locus Names:Z1523, ECs1267
Expression Region:1-137
Sequence Info:full length protein
