Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bifidobacterium adolescentis Lipoprotein signal peptidase(lspA)

Recombinant Bifidobacterium adolescentis Lipoprotein signal peptidase(lspA)

SKU:CSB-CF371515BOX

Regular price $1,787.00 USD
Regular price Sale price $1,787.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)

Uniprot NO.:A1A2I0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNDQRRLRDRVAVFACIAIAAIAIDQLTKMWALSALADGRTIRVIPGLLSLTLVRNPGA SLGMGSGMTWLISLLAMAACVALVVLAVRTISMKWTVLFAFAFAGAFGNLIDRVIYAEGF LNGKVVDFLNYGWSIGNVADIFLMLAGVAAVLLLFLGEPFSQKDLDEANGKTLGDDANAT DDGAKAA

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Ordered Locus Names:BAD_1132

Expression Region:1-187

Sequence Info:full length protein

View full details